Table 1 Identification of putative C. difficile SrtB substrates in strain 630
From: Clostridium difficilehas a single sortase, SrtB, that can be inhibited by small-molecule inhibitors
Protein | Function | C-terminal sorting signal |
|---|---|---|
CD630_01830 | Putative cell wall hydrolase | MIHSPSTGKTVSVTSINSSYYTARFVTA KRIL |
CD630_03860 | Putative cell surface protein, collagen binding protein | PSDSPKTGDNTNLYGLLALLLTSGAGLAGIFFY KRRKMKKS |
CD630_25370 | Putative membrane-associated 5'-nucleotidase/phosphoesterase | KEKSPKTGDLGFSNSIIIFIVSSTLICLLNFNQKELKDKKSK |
CD630_27680 | Putative cell-wall hydrolase | FIHSPQTGDVVKVTSMAPGTNYA RRLITATRVLQ |
CD630_28310 | Putative adhesion, collagen binding protein | PPVPPKTGDSTTIIGEILLVIGAIVGLIVL RRNKNTN |
CD630_31450 | Collagen binding protein, CbpA | VGQNVQTGDQSNIMLDLALMFISLFFLI KNLTNKYLRRK |
CD630_32460 | Putative surface protein | IVKSPKTGDETQLMSYVFISVIAICGLAYQCKIKRN |
CD630_33920 | Putative cell surface protein, collagen binding protein | PSDSPKTGDSTNLMAFIVMLLVSGGGLAGTYLY KRRKMKKS |